Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MW176074.1 | internal | 185 | 3-557(+) |
Amino Acid sequence : | |||
GFKAGVKDYRLTYYTPDYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVAGEENQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALR ALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGG | |||
Physicochemical properties | |||
Number of amino acids: | 185 | ||
Molecular weight: | 20,412.907 | ||
Theoretical pI: | 7.836 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
Instability index: | 27.156 | ||
aromaticity | 0.119 | ||
GRAVY | -0.319 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.232 | ||
sheet | 0.249 |