Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MW261918.1 | complete | 204 | 432-1046(+) |
Amino Acid sequence : | |||
MASDITLQNLSTSDQNSNELLPISTTNTTTSIVQPPTKARQKTPSSSKDRHTKVNGRGRRIRMPAMCAARIFQLTRELGHRSDGETIEWLLRNAEPSILAATGTGTLPSDLISTSSPAMA SSSPSVRCQAQPISCISGCPQGLFTVAPPQPNCRLDLCQPIGFDYSSAESIGYRHMPFTALLLQSSATETEERQQEAALSLGDH* | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 18,816.288 | ||
Theoretical pI: | 5.462 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45490 45490 | ||
Instability index: | 61.161 | ||
aromaticity | 0.102 | ||
GRAVY | -0.161 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.235 | ||
sheet | 0.289 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MW261918.1 | complete | 166 | 838-338(-) |
Amino Acid sequence : | |||
MHEIGCAWQRTEGEDDAMAGDEVDMRSDGRVPVPVAAKMEGSALRRSHSMVSPSDRWPNSRVSWNMRAAHMAGMRIRRPLPFTFVWRSLEEEGVFWRALVGGWTIDVVVFVVEMGSSSLE FWSEVERFWRVISEAMAVVTMVLDGGGSVFVRKSELGFGLEYRERA* | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 18,816.288 | ||
Theoretical pI: | 5.462 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45490 45490 | ||
Instability index: | 61.161 | ||
aromaticity | 0.102 | ||
GRAVY | -0.161 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.235 | ||
sheet | 0.289 |