Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MW261919.1 | complete | 299 | 226-1125(+) |
Amino Acid sequence : | |||
MDPKGSKQSQDLPNFLSLPNTQTNQQQTNMSENKAAEIKDFQIMVADKEETKKQLGPKRSSNKDRHTKVEGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQSEPSIIAATGTG TIPASALAATGGSVSQHGTSLSAGLHHRIDELGASNSNSRTSWAMLGGNLGRPHLATATGLWPSVSGFGYQSTTGPSTTNLGVAESSNYLQKIGFSGFDLPVTNMGPMSFTSILGSTNQQ IPGLELGLSQDGHIGVLNPQAFTQIYQQMGQARVHHQQHHEQQQPPPNDDSQGSGGGGQ* | |||
Physicochemical properties | |||
Number of amino acids: | 299 | ||
Molecular weight: | 31,988.131 | ||
Theoretical pI: | 7.958 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 49.301 | ||
aromaticity | 0.047 | ||
GRAVY | -0.652 | ||
Secondary Structure Fraction | |||
Helix | 0.204 | ||
turn | 0.328 | ||
sheet | 0.217 |