Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MW296986.1 | 5prime_partial | 154 | 3-467(+) |
Amino Acid sequence : | |||
DKHMTTGRINQVAFLIDVDLRMSRAKRLRHNGNERRPHEASNAFYFGTNRGRGPRTALLFRIRENKHCDMVQRVQALRAHESWNTSSATLSAPHRIPLGRSTRRKRVVETTSCLLDRYTT QETDVGQGNPQLEPIIEEACTRCRRCPSREPTCP* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 17,736.927 | ||
Theoretical pI: | 10.476 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
Instability index: | 60.356 | ||
aromaticity | 0.045 | ||
GRAVY | -0.895 | ||
Secondary Structure Fraction | |||
Helix | 0.201 | ||
turn | 0.221 | ||
sheet | 0.221 |