| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MW509056.1 | internal | 160 | 1-480(+) |
Amino Acid sequence : | |||
| TYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPP AYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSA | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 17,737.982 | ||
| Theoretical pI: | 5.702 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
| Instability index: | 29.780 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.263 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.225 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MW509056.1 | internal | 160 | 1-480(+) |
Amino Acid sequence : | |||
| TYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPP AYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSA | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 17,737.982 | ||
| Theoretical pI: | 5.702 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
| Instability index: | 29.780 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.263 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.225 | ||
| sheet | 0.238 | ||