Acc_NO	ORF type	length	start-end position (strand +/-)
>MW582310.1	5prime_partial	249	3-752(+)
Amino Acid sequence :
SLKCAIQLGIPDILHKHGHPMTLSQLLQSIPINKAKSQCLHRLMRVLVNSNFFIEEKNSNNQEVHYWLTPASRLLLKGAPLTVAPLVQVILDPTFTNPWHHMSEWFTHEHHATQFEAANG CMFWEKLANEPSMGRFFDEAMSCDARLVAHVLTKDYKHVIGGIRTLVDVGGGDGTMAKAXXEAVPTXKCTVIDLPHVMAGLESTDSLSYIGGDMFRSIPSADAVLLKVNSLSPXPXQXII YXXILKTKH*
Physicochemical properties
Number of amino acids:		249
Molecular weight:		26,768.745
Theoretical pI:		6.905
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		27960 28210
Instability index:		42.059
aromaticity		0.071
GRAVY		-0.027
Secondary Structure Fraction
Helix		0.311
turn		0.228
sheet		0.270