Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MW582310.1 | 5prime_partial | 249 | 3-752(+) |
Amino Acid sequence : | |||
SLKCAIQLGIPDILHKHGHPMTLSQLLQSIPINKAKSQCLHRLMRVLVNSNFFIEEKNSNNQEVHYWLTPASRLLLKGAPLTVAPLVQVILDPTFTNPWHHMSEWFTHEHHATQFEAANG CMFWEKLANEPSMGRFFDEAMSCDARLVAHVLTKDYKHVIGGIRTLVDVGGGDGTMAKAXXEAVPTXKCTVIDLPHVMAGLESTDSLSYIGGDMFRSIPSADAVLLKVNSLSPXPXQXII YXXILKTKH* | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 26,768.745 | ||
Theoretical pI: | 6.905 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
Instability index: | 42.059 | ||
aromaticity | 0.071 | ||
GRAVY | -0.027 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.228 | ||
sheet | 0.270 |