Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MW628908.1 | internal | 166 | 3-500(+) |
Amino Acid sequence : | |||
YKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLR IPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNY | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 18,596.989 | ||
Theoretical pI: | 8.777 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
Instability index: | 19.958 | ||
aromaticity | 0.120 | ||
GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.211 | ||
sheet | 0.235 |