Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MW633172.1 | internal | 272 | 1-816(+) |
Amino Acid sequence : | |||
LNFVLDILIPRSVHVEILIQTLRLWVKDVSSLHLLRVFLNEYWNWNSLLTTKKVSFSLLKRNQRLFFFLYNSHVCEYESIFVFLRNQFFHLRSTSSGVLLERIYFSIKIERLMNVFVKDF RTNLGLVEEPCMHYIRYQRKSILASKGTSFFVNKWKFYLVTFWQWHFSVWFHPKRISINQFSKHSLEILGYLSNVQMNPSVVRSQILENAFLINNAIKKLDTLVPIIPLIAELAKAKFCN VLGHPISKPIWADLSDSNIIDRFARICRNISH | |||
Physicochemical properties | |||
Number of amino acids: | 272 | ||
Molecular weight: | 32,316.572 | ||
Theoretical pI: | 9.916 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 55920 56170 | ||
Instability index: | 36.990 | ||
aromaticity | 0.143 | ||
GRAVY | 0.150 | ||
Secondary Structure Fraction | |||
Helix | 0.445 | ||
turn | 0.213 | ||
sheet | 0.213 |