Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MW633180.1 | internal | 171 | 2-514(+) |
Amino Acid sequence : | |||
EYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDL RIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAV | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 19,060.493 | ||
Theoretical pI: | 6.998 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
Instability index: | 28.011 | ||
aromaticity | 0.117 | ||
GRAVY | -0.319 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.222 | ||
sheet | 0.240 |