Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MW776604.1 | complete | 125 | 584-961(+) |
Amino Acid sequence : | |||
MNRIFICRDIVSTYCKEVRALGFWLQEAISESLGLHKDCLKNVLGEQGQHMAINFYPACPEPDLTFGLPAHTDPNALTILLQDLLVSGLQVLKDGKWLAIKPQPDAFVINIGDQIQVNTI CTIVM* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 11,662.106 | ||
Theoretical pI: | 9.327 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20190 | ||
Instability index: | 38.838 | ||
aromaticity | 0.139 | ||
GRAVY | -0.414 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.267 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MW776604.1 | complete | 101 | 1253-1558(+) |
Amino Acid sequence : | |||
MHKKNSFSISLLNYLCNSLLQAFSNGKYRSVWHRAVVNSNKARLSVASFLCPCDAANISAPNELTTGNDRAIYRGFTYAEYYKKFWSRNLDQEHCLELFKN* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,662.106 | ||
Theoretical pI: | 9.327 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20190 | ||
Instability index: | 38.838 | ||
aromaticity | 0.139 | ||
GRAVY | -0.414 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.267 | ||
sheet | 0.248 |