Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MZ190981.1 | 3prime_partial | 101 | 305-3(-) |
Amino Acid sequence : | |||
MVGFIRARCDARPGKASDASGRDSASQATACRAATRSGPWVSADRPRGNGGPTSASGTSPAIGRGWCRGATEGVTPRQACPRPDGSRAQLAFKDSMVHGIL | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 10,341.445 | ||
Theoretical pI: | 11.013 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 36.429 | ||
aromaticity | 0.040 | ||
GRAVY | -0.546 | ||
Secondary Structure Fraction | |||
Helix | 0.129 | ||
turn | 0.337 | ||
sheet | 0.208 |