| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MZ190983.1 | 5prime_partial | 123 | 3-374(+) |
Amino Acid sequence : | |||
| QNPVNHRVFERKLRPKPSGRGHVCLGVTHRVAPPSPRNALGLGGADTGLPCPRCAAGPNAIPRRPASRQXGVELLNFPVAPRVVRADXFKNPSTSTATPGQAGSPAEFKHINKRRKRNLQ GFP* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 13,006.791 | ||
| Theoretical pI: | 11.835 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 60.257 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.688 | ||
Secondary Structure Fraction | |||
| Helix | 0.198 | ||
| turn | 0.355 | ||
| sheet | 0.190 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MZ190983.1 | 5prime_partial | 123 | 3-374(+) |
Amino Acid sequence : | |||
| QNPVNHRVFERKLRPKPSGRGHVCLGVTHRVAPPSPRNALGLGGADTGLPCPRCAAGPNAIPRRPASRQXGVELLNFPVAPRVVRADXFKNPSTSTATPGQAGSPAEFKHINKRRKRNLQ GFP* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 13,006.791 | ||
| Theoretical pI: | 11.835 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 60.257 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.688 | ||
Secondary Structure Fraction | |||
| Helix | 0.198 | ||
| turn | 0.355 | ||
| sheet | 0.190 | ||