Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MZ190987.1 | complete | 147 | 2-445(+) |
Amino Acid sequence : | |||
MYAYSWCELQNPINHRVFDASCARSRQAEGTSAWASRIASPPLPSHRLGETGRILAPRAPRRAAGPNAIPRRLASRRVVVEHLNLAASRPRVVRTGIHERPNGAPHHRPRPQVRRDHPLS LSISISGGKETYKDSPSNGERTGKSPT* | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 13,175.781 | ||
Theoretical pI: | 11.842 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
Instability index: | 86.026 | ||
aromaticity | 0.042 | ||
GRAVY | -0.877 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.322 | ||
sheet | 0.186 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MZ190987.1 | 5prime_partial | 118 | 3-359(+) |
Amino Acid sequence : | |||
CMLIAGVNCRIQSTIESLTQVAPEAVRPRARLPGRHASRRPPSPRTAWERRGGYWPPVRPGARPAQMRSPGDSRRDEWWLNISISQRRAPASSGRASTNDPTVLRTIDRDPRSGGITR* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 13,175.781 | ||
Theoretical pI: | 11.842 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
Instability index: | 86.026 | ||
aromaticity | 0.042 | ||
GRAVY | -0.877 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.322 | ||
sheet | 0.186 |