Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>OK571351.1 | complete | 314 | 1-945(+) |
Amino Acid sequence : | |||
MDSADEIILDTAPFIVIYKSGRTERSLANDFVPPSVDPVDGVSSKDALISPETGVAARLYLPAGDPPGKKLPLLIYFHGGGFCVGSAFSTLSHNYMTSLVARANVVAVSVDYSLAPEHTL PAAFEDAWAALQWVASGGGGDEWLAQHSDFDRVYLLGESAGANISHHMALRAGSESLDRGVKIKGAVLIHPYFEGSDPVGSDLNDAELSEEMKRMWKLVFPSVSIDDPWISPLAGDAAAT LSGLGCERVLLCLADKDVFRDRGREYYHALKGSGWKGDVEMWEGDMGHLFHLANVKHEMALAQEGVITGFLNRD* | |||
Physicochemical properties | |||
Number of amino acids: | 314 | ||
Molecular weight: | 12,161.544 | ||
Theoretical pI: | 9.687 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
Instability index: | 69.511 | ||
aromaticity | 0.080 | ||
GRAVY | -0.423 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.354 | ||
sheet | 0.230 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>OK571351.1 | 5prime_partial | 182 | 3-551(+) |
Amino Acid sequence : | |||
GFGRRDHPGHRSVHRHIQERPHREVASQRLRTTIRRPRRRRLLQGRPHLAGDRRRRPPVPPRRRPPRQEAPPPHLLPRGRVLRRQRLQHPLAQLHDLPRRPRQRRRRLRRLQPRPRAHSP RRLRGRLGRAPVGGLRRRRRRVAGPALRLRPSVPPWGECGCEHIAPHGVARWVRVTRPRGQD* | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 12,161.544 | ||
Theoretical pI: | 9.687 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
Instability index: | 69.511 | ||
aromaticity | 0.080 | ||
GRAVY | -0.423 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.354 | ||
sheet | 0.230 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>OK571351.1 | 5prime_partial | 139 | 945-526(-) |
Amino Acid sequence : | |||
LIPIKEASNHPLLSQSHLMLHICQMKQMTHVPLPHLHVPLPPAPLQCMVVLPPSIPKHILIRQAQQHPLTAQPRQRRRRVAGKRTDPRIIDAHRREHQLPHTLHLLTQLSVIQIRPHRVA PFKVWVYQNRTLNLDPAVE* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 12,161.544 | ||
Theoretical pI: | 9.687 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
Instability index: | 69.511 | ||
aromaticity | 0.080 | ||
GRAVY | -0.423 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.354 | ||
sheet | 0.230 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>OK571351.1 | complete | 113 | 674-333(-) |
Amino Acid sequence : | |||
MLTDGNTSFHIRFISSLSSASFRSDPTGSLPSKYGCIRTAPLILTPRSSDSDPARNAMWCDMFAPALSPRRYTRSKSECWASHSSPPPPEATHWSAAQASSKAAGRVCSGARL* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,161.544 | ||
Theoretical pI: | 9.687 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
Instability index: | 69.511 | ||
aromaticity | 0.080 | ||
GRAVY | -0.423 | ||
Secondary Structure Fraction | |||
Helix | 0.186 | ||
turn | 0.354 | ||
sheet | 0.230 |