Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>OK571352.1 | complete | 182 | 1-549(+) |
Amino Acid sequence : | |||
MEPRSNSPLPPPAITLRPFVISDADAAIALRPFVPLDADADAPYTRTEDTEDYIRHRILPHPWYRAICVAGDSRPVGSISIQAETAFGADRRASVAYVVSRDWRGRGVATAALKAAAGAV FSHWPHLVRLEAVADVENRASQRVLEKAGFLKEGVLRKYMAFMGEPRDMVMYSFVPTDISPV* | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 11,712.476 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 138.764 | ||
aromaticity | 0.010 | ||
GRAVY | -1.620 | ||
Secondary Structure Fraction | |||
Helix | 0.150 | ||
turn | 0.370 | ||
sheet | 0.090 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>OK571352.1 | internal | 183 | 549-1(-) |
Amino Acid sequence : | |||
SHWTDISGYEAIHDHVSRLPHERHVLPQHPLLQKPSLLQHPLRRPVLHVRHGLQPDQVRPVAEHRPRRGLQRRRRHPSAPPVTGHDVRDRRPAIRAKRGLGLDGDGPHGAAVAGDADGAV PWVGEDAVADVVLGVLCAGVWGVGVGVQGDEGAEGDGGVGVGDDEGAEGDRRRWERTVGAWFH | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 11,712.476 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 138.764 | ||
aromaticity | 0.010 | ||
GRAVY | -1.620 | ||
Secondary Structure Fraction | |||
Helix | 0.150 | ||
turn | 0.370 | ||
sheet | 0.090 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>OK571352.1 | 5prime_partial | 130 | 548-156(-) |
Amino Acid sequence : | |||
HTGLISVGTKLYMTMSLGSPMNAMYFLSTPSFRNPAFSSTLCDARFSTSATASSRTRCGQWLNTAPAAAFSAAVATPRPRQSRDTTYATDARRSAPNAVSAWMEMDPTGRLSPATQMARY HGWGRMRWRM* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 11,712.476 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 138.764 | ||
aromaticity | 0.010 | ||
GRAVY | -1.620 | ||
Secondary Structure Fraction | |||
Helix | 0.150 | ||
turn | 0.370 | ||
sheet | 0.090 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>OK571352.1 | 5prime_partial | 112 | 2-340(+) |
Amino Acid sequence : | |||
WNHAPTVLSHRRRSPSAPSSSPTPTPPSPSAPSSPWTPTPTPHTPAQRTPRTTSATASSPTHGTAPSASPATAAPWGPSPSRPRPRLARIAGRRSRTSCPVTGGAEGWRRRR* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 11,712.476 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 138.764 | ||
aromaticity | 0.010 | ||
GRAVY | -1.620 | ||
Secondary Structure Fraction | |||
Helix | 0.150 | ||
turn | 0.370 | ||
sheet | 0.090 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>OK571352.1 | 5prime_partial | 100 | 3-305(+) |
Amino Acid sequence : | |||
GTTLQQSSPTAGDHPPPLRHLRRRRRHRPPPLRPPGRRRRRPIHPHRGHRGLHPPPHPPPPMVPRHLRRRRQPPRGVHLHPGRDRVWRGSPGVGRVRRVP* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,712.476 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 138.764 | ||
aromaticity | 0.010 | ||
GRAVY | -1.620 | ||
Secondary Structure Fraction | |||
Helix | 0.150 | ||
turn | 0.370 | ||
sheet | 0.090 |