Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>X84107.1 | 3prime_partial | 196 | 1-588(+) |
Amino Acid sequence : | |||
MSRYRGPRLKKIRRLGALPGLTSKGTRPGSDLRNQFRSGKRSQYRIRLEEKQKLRFHYGLTERQLLRYVHIAGKAKGSTGQVLLQLLEMRLDNILFRLGMAPTIPGARQLLNHRHILVNG RIVDIPSYRCKPRDIITTKDKQRSKVLIQNNMDSSTREELPKHLTLDSFQHKGLVNQIIDSKWVGLKINELLVVEY | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 22,729.345 | ||
Theoretical pI: | 10.875 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
Instability index: | 44.248 | ||
aromaticity | 0.056 | ||
GRAVY | -0.579 | ||
Secondary Structure Fraction | |||
Helix | 0.316 | ||
turn | 0.219 | ||
sheet | 0.230 |