Acc_NO	ORF type	length	start-end position (strand +/-)
>X84145.1	3prime_partial	202	1-606(+)
Amino Acid sequence :
MSRYRGPRLKIINRLKTLPGLSKKKPNRIEEPRTKKHHKSPKPSKYPIRLKEKQRVRFHYGLTERQLLQYARIARRSKGSTGQVLLQLLEMRLDNIIFRLGMALTIPGARQLVSHRHILV NDRIVDIPSYRCKPQDLISIKDQQRSINIINNNIDLSQRDKMRVPNHLNLLKKKSQYIGLVKKIIDSKRISLKINELLVVEY
Physicochemical properties
Number of amino acids:		202
Molecular weight:		23,791.954
Theoretical pI:		10.965
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		10430 10430
Instability index:		49.503
aromaticity		0.045
GRAVY		-0.634
Secondary Structure Fraction
Helix		0.327
turn		0.218
sheet		0.203