Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>X87827.1 | 5prime_partial | 154 | 1-465(+) |
Amino Acid sequence : | |||
AKGMHLGQAAVSQEPLSGVRRPSQISNLNPSMSQRPTGQTQAFLPGEVGSPPSGHEPHAGYMHTMANPSYLMPHFAQSSPSRLGQQPLYRFNQGRPAVHYNESHAKAQSSHSTYNTDAPN SAPRNGASWGRRGSNPIPNIPPTSRTRKDYKRVV* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 16,748.380 | ||
Theoretical pI: | 10.721 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
Instability index: | 77.316 | ||
aromaticity | 0.065 | ||
GRAVY | -0.963 | ||
Secondary Structure Fraction | |||
Helix | 0.169 | ||
turn | 0.403 | ||
sheet | 0.188 |