Acc_NO	ORF type	length	start-end position (strand +/-)
>X87827.1	5prime_partial	154	1-465(+)
Amino Acid sequence :
AKGMHLGQAAVSQEPLSGVRRPSQISNLNPSMSQRPTGQTQAFLPGEVGSPPSGHEPHAGYMHTMANPSYLMPHFAQSSPSRLGQQPLYRFNQGRPAVHYNESHAKAQSSHSTYNTDAPN SAPRNGASWGRRGSNPIPNIPPTSRTRKDYKRVV*
Physicochemical properties
Number of amino acids:		154
Molecular weight:		16,748.380
Theoretical pI:		10.721
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		14440 14440
Instability index:		77.316
aromaticity		0.065
GRAVY		-0.963
Secondary Structure Fraction
Helix		0.169
turn		0.403
sheet		0.188