Acc_NO	ORF type	length	start-end position (strand +/-)
>Y13796.1	internal	193	3-581(+)
Amino Acid sequence :
DEHGEVVAEIRRSDLEPYLGLHYPATDIPQASRFLFMQNRVRMICDCRATPVKVIQSGELKQPLCLVGSTLRAPHGCHAQYMANMGSIASLVMAVIVNGNGNGNDEDGGGGSGRSSMKLW GLVVCHHTSPRAVPFPLRSACEFLMQTFGLQINMELQLAAQLIENNILRTQTLLCDMLLRDAPIGILTQSPSI
Physicochemical properties
Number of amino acids:		193
Molecular weight:		21,057.183
Theoretical pI:		6.311
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10345
Instability index:		65.758
aromaticity		0.047
GRAVY		0.031
Secondary Structure Fraction
Helix		0.290
turn		0.259
sheet		0.285