Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>Z80856.1 | internal | 148 | 1-444(+) |
Amino Acid sequence : | |||
FVAPECFSLCSYLLSGYTKRDLRSNEATMKYLLMGGASSSILVHGFSWLYGLSGGEIELQEIVNGLINTQMYNSPGISIALIFITVGIGFKLSLAPFHQWTPDVYEGSPTPVVAFLSVTS KVAASASATRIFDIPFYFSSNEWHLLLE | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,228.459 | ||
Theoretical pI: | 5.259 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
Instability index: | 41.624 | ||
aromaticity | 0.135 | ||
GRAVY | 0.396 | ||
Secondary Structure Fraction | |||
Helix | 0.392 | ||
turn | 0.291 | ||
sheet | 0.264 |